SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219847547|ref|YP_002461980.1| from Chloroflexus aggregans DSM 9485

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219847547|ref|YP_002461980.1|
Domain Number 1 Region: 6-236
Classification Level Classification E-value
Superfamily Aromatic aminoacid monoxygenases, catalytic and oligomerization domains 3.27e-78
Family Aromatic aminoacid monoxygenases, catalytic and oligomerization domains 0.00000736
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|219847547|ref|YP_002461980.1|
Sequence length 243
Comment aromatic amino acid hydroxylase [Chloroflexus aggregans DSM 9485]
Sequence
MATIAPPALPAYTDEDHAVWATLCARQVPRLERYACRLFREGFRKLNLDLQRLPDPMQVS
ERLAAMTGWTLCDAQNEYLNPTEWFEHIAERRFPVTNYIRRMDELDFTPLPDLFHEYIGH
LAFFTDQRFADIAQAFGPLYFAGDERQRLEIARLWWYSIEFGLIREDGELRAFGAGLLSS
IGELDHAFAPTTPRVPFDIRRVANTPGAAYSMHETYFILDDLEHVARILRKYAAMEGLPP
VNV
Download sequence
Identical sequences B8G4D8
gi|219847547|ref|YP_002461980.1| 326427.Cagg_0605 WP_012615910.1.86148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]