SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219850525|ref|YP_002464958.1| from Chloroflexus aggregans DSM 9485

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219850525|ref|YP_002464958.1|
Domain Number 1 Region: 36-142
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000273
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|219850525|ref|YP_002464958.1|
Sequence length 245
Comment hypothetical protein Cagg_3686 [Chloroflexus aggregans DSM 9485]
Sequence
MVILNATLDIRVESVDQAEDRVRDIADRLGGYILHIRAQGREQTRESYITFRVPFENFER
ALTEIEGLAKEIVSRTVDGEDITEQYVDLRSRLRNLEATHDRIKALLESSQRLEDTLLLY
QRLSEIQGQIEQIKGRMRYLEQNTNFSTISVIMRPASMVEEKPAPTPTWDPGKIVVEQFG
LLRAFGESILTIVLILAIWSPVWIIPVGILIWFWRRWHPAVYGEHQGKGISGRQPITTSV
TSEEK
Download sequence
Identical sequences B8GAE7
WP_015942367.1.86148 326427.Cagg_3686 gi|219850525|ref|YP_002464958.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]