SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|325964605|ref|YP_004242511.1| from Arthrobacter phenanthrenivorans Sphe3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325964605|ref|YP_004242511.1|
Domain Number 1 Region: 93-221
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.23e-22
Family GntR ligand-binding domain-like 0.011
Further Details:      
 
Domain Number 2 Region: 2-63
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.2e-16
Family GntR-like transcriptional regulators 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|325964605|ref|YP_004242511.1|
Sequence length 236
Comment GntR family transcriptional regulator [Arthrobacter phenanthrenivorans Sphe3]
Sequence
MKTHQLVLAWIENQLSEGRLAVGGRLPAERSLAEQLKVSRTSVREAIRILEAMGVVRAGV
GSGPDAGTVVISDPTAALGSALRLHVATQHLPVADIVETRVLLESWAVAHARRDSPELQA
AARLLAEMDAETVGVDEFLALDVRFHLALADAAGNAVVSAMMGSLRESITGYASRLTGNL
PDWNATAARLRCEHRDILAAVQNDDGERAAQLVAAHIEGYYKEAGLASGGTVPIRP
Download sequence
Identical sequences F0M3A2
gi|325964605|ref|YP_004242511.1| WP_013602267.1.14739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]