SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|218440163|ref|YP_002378492.1| from Cyanothece sp. PCC 7424

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218440163|ref|YP_002378492.1|
Domain Number 1 Region: 65-142
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000011
Family Collagen-binding domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|218440163|ref|YP_002378492.1|
Sequence length 149
Comment peptidase domain-containing protein [Cyanothece sp. PCC 7424]
Sequence
MKHSLGKRWYSVLFLATSILTIGYPLPIFAQKLYSPLPLPNNNQVSDTLTDQDIPTGEGG
FARDYFIDLDEGDQVAVDLISDDFDAIVILMASDGSTIAENDDGPDGSTNSLLFTRITER
GRYIIRVRAFGETGSGNYTLKVTRLRPVN
Download sequence
Identical sequences B7KCS3
gi|218440163|ref|YP_002378492.1| WP_015955221.1.63236 65393.PCC7424_3224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]