SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428318454|ref|YP_007116336.1| from Oscillatoria nigro-viridis PCC 7112

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428318454|ref|YP_007116336.1|
Domain Number 1 Region: 17-305
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.16e-56
Family Protein kinases, catalytic subunit 0.00024
Further Details:      
 
Domain Number 2 Region: 417-524
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 1.57e-30
Family Pentapeptide repeats 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428318454|ref|YP_007116336.1|
Sequence length 543
Comment serine/threonine protein kinase with pentapeptide repeats [Oscillatoria nigro-viridis PCC 7112]
Sequence
MSYCVNPGCPHPQNPADSILQCQTCGARLLLRARYRVIEPLGQGGFGATFLAKDISLPGQ
PSCVVKQLRPSSSSPRVLEMARELFKREAKTLGQLGDHPQVPRLLDYFETEQQFYLVQEY
VRGSTLKQEVKHSGRFNESDVKNFLLEILPVVQYIHSQGVIHRDIKPANIIRRVQDGHLV
LIDFGAVKDQVSQTILLDPADQSANTKFSVGTFSFAPPEQMALRPIFASDIYALGMTCLY
LLTGKSPKDLDFDGVTGEIVWQPHVQLSPNFARILEKMLKPMVGHRFQSAADVLRALSGE
FEDPSLVDGLATQFHGSSRAVEEPTIFNDEGSSWSPPRSKINQDLRSNHTRPGRTSFSQS
GNTGMQPRVSRTLAESGRTFGTVGPSSDNLAASKLSKVAPKWDTNSVRAAYFKGKRDFAD
CELSGLQLQKLQLAGSNFYQARLVKANLQAADLSGANLGHARLIQANLRDANLTEAYCST
ANFEGADFRGADLTGAYLTKANLRGANLCGANLTNATVSDEQLAMAKTNWLTVKPDGKRS
FGF
Download sequence
Identical sequences K9VL09
gi|428318454|ref|YP_007116336.1| WP_015177180.1.100662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]