SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|68536177|ref|YP_250882.1| from Corynebacterium jeikeium K411

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|68536177|ref|YP_250882.1|
Domain Number 1 Region: 51-302
Classification Level Classification E-value
Superfamily Cgl1923-like 5.62e-76
Family Cgl1923-like 0.000000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|68536177|ref|YP_250882.1|
Sequence length 359
Comment hypothetical protein jk1100 [Corynebacterium jeikeium K411]
Sequence
MHQHFENNGDEHNGRHERKAAGRMYEMEYPAPIQFDRPSIADEATGLGSAVEGSEELPML
VALQGYADAGQAVSSASSHLLAALEHSPVASFKVDELIDYRSRRPGVTIDNSKVMDSDDV
RLDLHLLKDTQGRPFLLLSGLEPDLKWGAFSDAVVDLARRGQVGMVASLYSAPMTVPHTR
PLVISAHSSDSSLIQDFHTWDSRMIVPGAAALETEKKLNRHGFETVGLTAHVPHYIAASD
YPEAPLRLLQAFGKVANRELPLKALEKELERVQHQLQDQVEDSQEIATVVSALEHQYDAE
MERMRRKRENNLLKPGQDIPTGEELGAEFEAFLQNMSDGDLSDENGADNSADSDEQEEN
Download sequence
Identical sequences A0A1G4W3R3 Q4JV93
306537.jk1100 WP_005295073.1.55873 WP_005295073.1.56325 WP_005295073.1.58937 WP_005295073.1.71728 WP_005295073.1.81854 WP_005295073.1.86212 gi|68536177|ref|YP_250882.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]