SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|328955153|ref|YP_004372486.1| from Coriobacterium glomerans PW2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|328955153|ref|YP_004372486.1|
Domain Number 1 Region: 102-213
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.000000000000154
Family GntR ligand-binding domain-like 0.015
Further Details:      
 
Domain Number 2 Region: 29-98
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000333
Family Transcription factor E/IIe-alpha, N-terminal domain 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|328955153|ref|YP_004372486.1|
Sequence length 252
Comment GntR family transcriptional regulator [Coriobacterium glomerans PW2]
Sequence
MANKDSSRAVVRVGVDAAERMQRLMRKKDESSIEYAYRTLEYNIMMLKIPPAAFIREAEI
AQRLNMSKTPVHQAINLLRDQTLVDVKARSATHVSRVDLNALDQGFFLRATVEPAVIYHL
METGTPKELSRLQTNLDAQRTLLANQADPYGYIGLDDAFHRIIYQMAGKDLVWSSIKKVT
AHFDRVRYMGLVFGYEAPNDNEHHDIFEILTGKTKTTEEQIRWTVSHHLSHYLSFFEQMK
TDHPDFFVSSNS
Download sequence
Identical sequences F2NBD5
WP_013708414.1.79872 gi|328955153|ref|YP_004372486.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]