SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|328956343|ref|YP_004373676.1| from Coriobacterium glomerans PW2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|328956343|ref|YP_004373676.1|
Domain Number 1 Region: 101-308
Classification Level Classification E-value
Superfamily Sortase 1.08e-30
Family Sortase 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|328956343|ref|YP_004373676.1|
Sequence length 317
Comment peptidase C60 sortase A and B [Coriobacterium glomerans PW2]
Sequence
MGAYQPKRFAHPDGRRAGSTFGTAQSADAPRHARSSGLAPMPRRSSCGAHARSAHACADD
PHRGRRPRGNRRIVSTLLLLVGLALAGAAAYIFISAQLGYHEAVDSYSGLTKYAHISEGD
DDVPPKVDFDQLNAINPEIVGWIYIPGTNINYPVAQASDNEKYLTTLFDGKKNPSGSIFM
DASCTSPGMIDQQTSLYGHHMNNKTMFYQVNDTTDQAAFDKITIAYYITREGTSKLRPLL
TAVVPDSYSKARARTFIGDGALSDYLRDIMKSAKAKAPDAEERLDSTEKVLSLITCSSEI
PTSDRTVMVLTLEQSDS
Download sequence
Identical sequences F2N9B3
gi|328956343|ref|YP_004373676.1| WP_013709603.1.79872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]