SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|328956366|ref|YP_004373699.1| from Coriobacterium glomerans PW2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|328956366|ref|YP_004373699.1|
Domain Number 1 Region: 70-242
Classification Level Classification E-value
Superfamily Sortase 0.000000000000177
Family Sortase 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|328956366|ref|YP_004373699.1|
Sequence length 248
Comment hypothetical protein Corgl_1789 [Coriobacterium glomerans PW2]
Sequence
MSGRHQTTDRGDPRRRVLLCAATLLALVSVETCSIQASFQQMAQMHNTGVDAESTRYREI
QGTRGDAVPEMPRILVRGTEIDYSIAQDRSDLADGFFLSHDPSGAPRRSGCPFIDRRSSL
DARHILIYGHNLGAGSGMFSELEDAWHQRILEAIGDAVLYLPDGTTTEFSPICAERVNER
YADVQRFGFSDEADLREWVCSIARESQAAIADWHKTAGNARRVLTLVTCSSARPSERLRT
LIVFASST
Download sequence
Identical sequences F2N9D6
gi|328956366|ref|YP_004373699.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]