SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|332795867|ref|YP_004457367.1| from Acidianus hospitalis W1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|332795867|ref|YP_004457367.1|
Domain Number - Region: 5-41
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0015
Family DNA-binding protein Mj223 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|332795867|ref|YP_004457367.1|
Sequence length 41
Comment hypothetical protein Ahos_0177 [Acidianus hospitalis W1]
Sequence
MSTGATWSELLEKSRVSTETLLNFLDKLERLYIIEKVEKNY
Download sequence
Identical sequences F4B4I0
gi|332795867|ref|YP_004457367.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]