SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|332796076|ref|YP_004457576.1| from Acidianus hospitalis W1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332796076|ref|YP_004457576.1|
Domain Number 1 Region: 4-183,347-433
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.28e-51
Family Bacterial dinuclear zinc exopeptidases 0.0014
Further Details:      
 
Weak hits

Sequence:  gi|332796076|ref|YP_004457576.1|
Domain Number - Region: 295-334
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.00314
Family Bacterial exopeptidase dimerisation domain 0.014
Further Details:      
 
Domain Number - Region: 223-268
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0602
Family Apolipoprotein 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|332796076|ref|YP_004457576.1|
Sequence length 437
Comment peptidase M20 [Acidianus hospitalis W1]
Sequence
MEFSKEELDFFLSKYQEFLKIPSISATGEGIRNASSWLKEFMEELGIKTEIVETKGHPVV
YGKVNNGGSKTLLVYNHYDVQPVDPINEWKYPPFSATISDGYIFARGASDNKGTLIARLL
AFSKYKGKLNFNFVFEGEEEIGSIHLNEFIQSRKEELSKSSAVIMEGAGLDTKGRPMIVL
GVKGLVYVQITVRVGERDVHSSVAPLIKNPVWELIKILNTIYDGEKVKIEGFYEDIEPLS
KEVEELLDKIELDVEEYRKSLGVYSFNYKDRKEVVKALYTYPSCNIDGIFAGYIGQGSKT
IVPSYAMAKMDFRLVPKQDPEKIYRELEKIVKAMGGEIVEMGLEKPVRTSPNTAVVKAMI
SSAVKAYSKDPVILPNAAGTQPMGLFYDLGIKEIVSAIGVGTPSSNAHAPNENVKLENFY
KAIEHSLYFYQEYESLG
Download sequence
Identical sequences F4B5R3
gi|332796076|ref|YP_004457576.1| WP_013775194.1.74519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]