SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|332796103|ref|YP_004457603.1| from Acidianus hospitalis W1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332796103|ref|YP_004457603.1|
Domain Number 1 Region: 6-202,304-392
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 5.76e-85
Family Bacterial dinuclear zinc exopeptidases 0.00001
Further Details:      
 
Domain Number 2 Region: 189-296
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 1.14e-28
Family Bacterial exopeptidase dimerisation domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|332796103|ref|YP_004457603.1|
Sequence length 394
Comment amidohydrolase [Acidianus hospitalis W1]
Sequence
MDIEKLKKDVLEIEDKIIEIRRKIHENPELSYKEYNTAKLVAETLKSLGIEVKVGVGLPT
AVLGILKTSKPGKVVALRADMDALPVEEMTDLPFKSKIKGVMHACGHDTHVAMLLGGAML
LAKNIDMLSGEVRFIFQPAEEDGGLGGAKPMIDAGVMDGVDYVFGLHISSAYPAGVFATR
KGPLMATPDAFKITVHGKGGHGSAPHETIDPIYISLLIANAIYGITARQIDPVQPFIISI
TSIHSGTKDNIIPDDAVMEGTIRSLDENVRKKALDYMERIVSSICGIYGAECKVEFMKDV
YPITVNDPETTEEVMRILNNISKVEETQPILGAEDFSRFLQKAKGTYFFLGTRNEKLGCI
YPNHSSKFCVDESVLKLGALAHAALSIEFTNKKE
Download sequence
Identical sequences F4B5U0
gi|332796103|ref|YP_004457603.1| WP_013775221.1.74519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]