SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|332796521|ref|YP_004458021.1| from Acidianus hospitalis W1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332796521|ref|YP_004458021.1|
Domain Number 1 Region: 1-251
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.53e-70
Family G proteins 0.0000035
Further Details:      
 
Domain Number 2 Region: 456-616
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.53e-51
Family Translational machinery components 0.0000333
Further Details:      
 
Domain Number 3 Region: 248-366
Classification Level Classification E-value
Superfamily Translation proteins 1.81e-30
Family Elongation factors 0.001
Further Details:      
 
Domain Number 4 Region: 380-456
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 4.32e-22
Family EF-G/eEF-2 domains III and V 0.00041
Further Details:      
 
Domain Number 5 Region: 617-708
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 4.68e-22
Family EF-G/eEF-2 domains III and V 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|332796521|ref|YP_004458021.1|
Sequence length 723
Comment translation elongation factor aEF-2 [Acidianus hospitalis W1]
Sequence
MKDIERVRNIGIIAHVDHGKTTTSDTLLAAAGIISPKVAGEALALDYLSVEQQRGITVKA
ANVSLYHEVDGKGYVINLIDTPGHVDFSGRVTRSLRVLDGSIVVVDAVEGVMTQTETVLR
QSLEERVRPILFINKIDRLVKELKLGPQEMMQKLLDIIKSVNDLIDMYAEPEFKDKWMVN
PTQGTVVFGSAKDKWGFTLPIAQKKGINMKNVIDAYTSSDKNKINELASQVPIHEALLDA
VIKFVPNPRDAQKYRIPKIWKGDMDNDLVKSMLNADPNGPIVMMINDMKVDPHAGLVATG
RVFSGTLRSGEEVWLVNAKSPQKILQVSIYMGQLRELADEIPAGNIAAVLGLDKARAGET
LVDINFKNLQGSFESLHYVSEPVVTIAVEPKNPKDLTKMIDALRKLTIEDPNLVVKINEE
TGEYLLSGMGFLHLEVSLQLLKDNYGIEVNTSPPIVVYRESIRAKSQVFEGKSPNKHNKF
YISVEPLNEQTIELITNGTIREDMDSKEMAKILRDQADWDYDEAKRIIAVDENVNLFVDM
TSGIQHLREIMDTLLQGFRLAMREGPLAHEPIRGLKVVLHDAVVHEDPAHRGPAQIYPAV
RNAIFAGFLTSRPTLLEPLQKLDIRVPMDLVGNVTAVLTRKRGKILNMTQVGNVARILAE
IPVADSYELASDLRGATGGRAFWGTEFSRWAPVPDSLLMDVIMKIRERKGLPKQIPKPED
FLS
Download sequence
Identical sequences F4B8C4
gi|332796521|ref|YP_004458021.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]