SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|332796524|ref|YP_004458024.1| from Acidianus hospitalis W1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332796524|ref|YP_004458024.1|
Domain Number 1 Region: 7-178
Classification Level Classification E-value
Superfamily FMN-binding split barrel 5.89e-29
Family MTH863-like 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|332796524|ref|YP_004458024.1|
Sequence length 197
Comment hypothetical protein Ahos_0840 [Acidianus hospitalis W1]
Sequence
MELHEAIKNIFPSNGIYEVILGTKGIRDNISPIGVIVNENQLKVKLYKCTTTYQNILVYP
YCSINVVIDNPKMFYLALFNKSVKYNLIHGLPVVSDNVIFSNCKIIEDHTEYVILSLDPF
DVKYSRQKISAFNRGNCLFIDLLVNITRLDIFSREELESMLKVISYEIKVIKRTQPNLLD
IIREIEDLIRSKGYKLE
Download sequence
Identical sequences F4B8C7
gi|332796524|ref|YP_004458024.1| WP_013775642.1.74519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]