SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|332796589|ref|YP_004458089.1| from Acidianus hospitalis W1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332796589|ref|YP_004458089.1|
Domain Number 1 Region: 3-153
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 0.00000000000514
Family FAD-linked oxidases, N-terminal domain 0.078
Further Details:      
 
Weak hits

Sequence:  gi|332796589|ref|YP_004458089.1|
Domain Number - Region: 124-252
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 0.0229
Family Vanillyl-alcohol oxidase-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|332796589|ref|YP_004458089.1|
Sequence length 288
Comment FAD linked oxidase domain-containing protein [Acidianus hospitalis W1]
Sequence
MEVYNEKELYNSIKDAYLSGKKVMIIGYGKHSNPRKSDIYLKIKMDYYKIEKEGYVEAYA
GASVDKIREEASEHGLLLPCLYDGSIGGLLANNEFSPLSTRYGKPYDFTEKVFFITPFGK
ISWKIIIGSKGRLGAIYKARLKLFPKPTKVFTFEKSFNKKDETIAYVNKLMHLKPLAMLV
EYDGKYTIHASYDFNADIHGFSKDEGVATIEETNRNGYYVNTPTIEDFMNAIEDTQPIYA
YTVVGSGISKFYVADEDAIKKLNYFTHDDIPRVYWKLKAILDFKNIFA
Download sequence
Identical sequences F4B8S1
WP_013775707.1.74519 gi|332796589|ref|YP_004458089.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]