SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|332796685|ref|YP_004458185.1| from Acidianus hospitalis W1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332796685|ref|YP_004458185.1|
Domain Number 1 Region: 2-75
Classification Level Classification E-value
Superfamily SirA-like 0.000000000000432
Family SirA-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|332796685|ref|YP_004458185.1|
Sequence length 75
Comment SirA family protein [Acidianus hospitalis W1]
Sequence
MVKIYKKVDLTGTSCAGPIGELMGLMDEINRGEAVEALLKDEETKNMVVNWAKTVGLKIF
EERKEGNNFVVVVGK
Download sequence
Identical sequences F4B994
gi|332796685|ref|YP_004458185.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]