SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|332796817|ref|YP_004458317.1| from Acidianus hospitalis W1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|332796817|ref|YP_004458317.1|
Domain Number - Region: 35-99
Classification Level Classification E-value
Superfamily Prefoldin 0.00628
Family Prefoldin 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|332796817|ref|YP_004458317.1|
Sequence length 104
Comment hypothetical protein Ahos_1135 [Acidianus hospitalis W1]
Sequence
MKLRIDKLPKTDEDLEEIQQEIESEHHHHHHEEEGQSIEEVLGELYVRLQSLESKSKELE
DSSEMCKEEISRIYKILGKMLIALTTKDENEKIKNLKDILSTLE
Download sequence
Identical sequences F4BA22
WP_013775935.1.74519 gi|332796817|ref|YP_004458317.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]