SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332796823|ref|YP_004458323.1| from Acidianus hospitalis W1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332796823|ref|YP_004458323.1|
Domain Number 1 Region: 164-438
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 8.38e-77
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000109
Further Details:      
 
Domain Number 2 Region: 7-113
Classification Level Classification E-value
Superfamily tRNA-binding arm 1.88e-22
Family Seryl-tRNA synthetase (SerRS) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|332796823|ref|YP_004458323.1|
Sequence length 455
Comment seryl-tRNA synthetase [Acidianus hospitalis W1]
Sequence
MSWSLLELIRNNPDELIDSLKKRNMDTSLALKAVELDKKWRSILQEVEKLRHQHNEINSQ
IPKLKPEERKAKIEEAKKLLQILEAKEKELKEIEEQRDEILRSLPNIISPDVPVGPDDTY
NVPIKFWGKFKVYEKDLEEFKKQLNGAQVEYEIINWKLVGHADMLENVLKLGNTEKASQV
AGSRFYYLFDDLVWLDFALLLYAIDTMTSKGYRLVLPPYMLRGEVIHAVIDLDTFKDAIY
KIENDDLYLIATAEHPLAALYYKEDIEKEELPIKLVGISPAFRREAGAANKDLKGIFRVH
QFHKVEQFIFSLPEDSWKYHQELLSNAEEIFQGLGIPYRIVNIASGDLGACAAKKYDLEA
WMPAQAKFREMVSCSNCTDWQAFRMKIRYVDRKNNKKGYVHTLNSTAVASTRTITAILEN
FQNEDGTVEIPKVLRKYLEPFKAAPKDYIYPRKKK
Download sequence
Identical sequences F4BA28
WP_013775941.1.74519 gi|332796823|ref|YP_004458323.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]