SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|332797097|ref|YP_004458597.1| from Acidianus hospitalis W1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|332797097|ref|YP_004458597.1|
Domain Number - Region: 20-38
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0439
Family Classic zinc finger, C2H2 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|332797097|ref|YP_004458597.1|
Sequence length 97
Comment hypothetical protein Ahos_1416 [Acidianus hospitalis W1]
Sequence
MKATFTVIFKNLNSAIKVMEEKYVCLTCGKTFYSGQGIILTVADRKLYFHSKACAYKFLK
EVILNVDKDCISSTVKDVYKKYEDLAKKREENAKKKI
Download sequence
Identical sequences F4B4R9
gi|332797097|ref|YP_004458597.1| 2014254620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]