SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|332797100|ref|YP_004458600.1| from Acidianus hospitalis W1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332797100|ref|YP_004458600.1|
Domain Number 1 Region: 306-466
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.11e-64
Family DNA gyrase/MutL, second domain 0.000000192
Further Details:      
 
Domain Number 2 Region: 12-225
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.41e-37
Family DNA gyrase/MutL, N-terminal domain 0.0000000349
Further Details:      
 
Domain Number 3 Region: 228-301
Classification Level Classification E-value
Superfamily S13-like H2TH domain 0.000000000000017
Family Topoisomerase VI-B subunit middle domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|332797100|ref|YP_004458600.1|
Sequence length 527
Comment DNA topoisomerase VI subunit B [Acidianus hospitalis W1]
Sequence
MSEKFASISPAEFFKRNPELAGFSNPARALYQALREMVENSLDATDVHEILPSIKIIMDL
IDQDKQIYKLTVEDNGIGIPPHVVPDAFGRVLYSSKYVIRQTRGMYGLGVKAAVLYSQMY
QDRPVEIMTSPINSKRIYFFKLKIDVTKNEPIIYERSSILNDKGFHGTSVTLYLLGDWQR
SKARIYEYIKRTYIVAPYAEFFFKDPEGNVVYYKRLTTKIPEPPKEVKPHPYGVDIELLK
NMIAKQKNDYEVKDFLTKEFQSVGDVTALKILEMAKINPDKKIKSLKDDELARLTEAMKK
FEDFRPPSPDALSVIGADLIELSLKNMFNPEFVAALTRKPKAYQGHPFIVEVGIAYGGAI
QPMDEPLVLRYANKIPLIYDEKSDVIWKVVEEIDWKRYGIEEEQKPLVVMVHLCSTKVPY
KSAGKESIADVEEIEKEIKNGIMEVSRKLRLYISEKKKEEEARKKMLTYLKYIPEIARSL
AVFATDDKKELIPKVQDEIQSKLFEIVKKKLDVKDEEEYKMYKVEAL
Download sequence
Identical sequences F4B4S2
gi|332797100|ref|YP_004458600.1| WP_013776217.1.74519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]