SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|332797546|ref|YP_004459046.1| from Acidianus hospitalis W1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332797546|ref|YP_004459046.1|
Domain Number 1 Region: 4-116
Classification Level Classification E-value
Superfamily LigB-like 4.32e-27
Family LigB-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|332797546|ref|YP_004459046.1|
Sequence length 126
Comment extradiol ring-cleavage dioxygenase III subunit B [Acidianus hospitalis W1]
Sequence
MKGYYISHGSPLLLIEENEWKETLRNLGKKIRKEIDPETAIIISPHFFSWNGKFLIETQE
KLECIQDYYGFPEETYKYCYSAENDTDTVNNLLSTGLFTPDNNLGLDHGAWIPLYYNRLK
ASSRDG
Download sequence
Identical sequences F4B7C8
WP_013776663.1.74519 gi|332797546|ref|YP_004459046.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]