SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|332797680|ref|YP_004459180.1| from Acidianus hospitalis W1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332797680|ref|YP_004459180.1|
Domain Number 1 Region: 5-209
Classification Level Classification E-value
Superfamily CbiG N-terminal domain-like 3.4e-48
Family CbiG N-terminal domain-like 0.00000282
Further Details:      
 
Domain Number 2 Region: 203-320
Classification Level Classification E-value
Superfamily CobE/GbiG C-terminal domain-like 2.49e-23
Family CobE/GbiG C-terminal domain-like 0.0000752
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|332797680|ref|YP_004459180.1|
Sequence length 323
Comment cobalamin (vitamin B12) biosynthesis protein CbiG [Acidianus hospitalis W1]
Sequence
MERAWRGFAIVYASKNNIAERLCEEMKKREVPCSLFSYKEADFENIWKCYDGIIFTMALS
GAVRTVCKYAQSKDKDPAVIAIDDEGKFVIPILGAHWGANEYAEEIARLLDSTPVITTAS
ELSNITSVEEFAKLINCKILNVENIVKITSALLRGEEVCVKGLKALPKVKGKYKIGDDCK
YFVIIGENQGNNDNAVYLRPLKLSIGIGSKIETDERTIEEAILFALNKINADITQVEVIS
SVREKVRKVAEKLGVKFRLLSIDEVNSFKDECLSPQSEKLKELGIRSVAEACALISAGKN
AKLILRKIPYKGEVTVSIASIGD
Download sequence
Identical sequences F4B858
gi|332797680|ref|YP_004459180.1| WP_013776797.1.74519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]