SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|332797933|ref|YP_004459433.1| from Acidianus hospitalis W1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332797933|ref|YP_004459433.1|
Domain Number 1 Region: 1-66,139-317
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 8.03e-76
Family Pyruvate kinase 0.0000218
Further Details:      
 
Domain Number 2 Region: 301-443
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 7.2e-30
Family Pyruvate kinase, C-terminal domain 0.0044
Further Details:      
 
Domain Number 3 Region: 62-148
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 6.63e-16
Family Pyruvate kinase beta-barrel domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|332797933|ref|YP_004459433.1|
Sequence length 445
Comment pyruvate kinase [Acidianus hospitalis W1]
Sequence
MRKTKIIATLGPSSIDKVKELSQYVDIFRINFAHGDTKSHKEYFEKIKEYSDASILVDLP
GPKIRVGDIKGKIVLKPGDKVVFSPYEGIPVEDPLFYSGVKENSYVLIADGSIKINVTKV
EKDRVEGVVIEGGTVTSRKGINIPDIKIPSGVTDNDLQLLKEALDLGADFIGLSFVLSKD
DVLKVKGISKDRAWIIAKIEKKNAVENLKDIIKVADGVMVARGDLGVEIGLENLPFTQKK
IIRLSKLYGKPVILATQVLESMVNNPIPTRAEVIDISNSVSEGVDAIMLSDETAAGNYPV
EAVKTLHDIILAVEKRVKTVRPPPLTGDDAIAVASVNVAEISKAKLLVVHSRSGTSIIRI
SRLRPKVPIIGLSPNKELIRKLKICWGVYPFLTEKSLITLNDIIAYAEEISKKFAKCNEN
IVITGGDPTLEEGRTDFIKLHQIVC
Download sequence
Identical sequences F4B9I9
WP_013777050.1.74519 gi|332797933|ref|YP_004459433.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]