SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|332797945|ref|YP_004459445.1| from Acidianus hospitalis W1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332797945|ref|YP_004459445.1|
Domain Number 1 Region: 2-177
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.78e-53
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.0000718
Further Details:      
 
Domain Number 2 Region: 182-293
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 1.36e-26
Family HCDH C-domain-like 0.00048
Further Details:      
 
Domain Number 3 Region: 297-387
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 1.7e-22
Family HCDH C-domain-like 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|332797945|ref|YP_004459445.1|
Sequence length 388
Comment 3-hydroxybutyryl-CoA dehydrogenase [Acidianus hospitalis W1]
Sequence
MKFAVVGSGTMGHGIAEVLAIYGHQVKLIDISWDILNRAKQRMEESLRKFYEKGTVKEDP
SVILSRIEMSTSYDVAKDIDFAIEAVPEILDLKRKVFQSLDEIAPKEAILATNTSSIPIS
EIAEFTSRKDKVIGMHFFNPPQIMKLVEVIPSKYTSEDTANKTVELARSLGKVPVKLRIE
VPGFIGNRIFLRLMQEACREVESGEASIEEVDSCARNKIGLPMGIFELSDYVGLDIDVDL
WENIVKRGTSDVPCKLFKEKVARKELGVKSGKGFYEYPGNKYLKVKLPATSKVDPARLLS
LAVNEAAWLVENNIVKPSEVDDVMKYGYNFPKGLLEIADELGIDNILRNLEDIYNKGYSA
YKPQDLLVKMVKEGKVGKKSGEGFYKYA
Download sequence
Identical sequences F4B9K1
WP_013777062.1.74519 gi|332797945|ref|YP_004459445.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]