SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LjSGA_016132.2 from Lotus japonicus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LjSGA_016132.2
Domain Number 1 Region: 49-160
Classification Level Classification E-value
Superfamily TPR-like 1.37e-28
Family Tetratricopeptide repeat (TPR) 0.002
Further Details:      
 
Domain Number 2 Region: 162-266
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000697
Family Thioltransferase 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LjSGA_016132.2
Sequence length 276
Comment - phase: 0
Sequence
MNPSLIEFCGFNRFEDALTAAQQAARVDPSNREVNAVLRRARAVTSARMSGNLLFKASKF
TEACAVYNEGLEHDPQNSVLLCNRAACRSKLGQYEKAIEDCNAALMVVPGYSKAVLRRAD
CNAKLEHWEAAIQDYEMLLREKPGDEEVAKALFEAQLQLKMIRGEDTKDLKFGSNLVFIS
SNDRFRHYVTSPGMAVVLFSNKATHKQVLLVLEQTSKRFPSVNFLKVEIEDHPYLAKSEG
VTSVPAFKIYKNGSKVKEISGNKHELLERSVKLYSS
Download sequence
Identical sequences LjSGA_016132.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]