SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for chr1.CM0195.330.nc from Lotus japonicus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  chr1.CM0195.330.nc
Domain Number 1 Region: 184-250
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.17e-21
Family DNA-binding domain from rap30 0.0023
Further Details:      
 
Domain Number 2 Region: 9-118
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 0.0000000000000131
Family Rap30/74 interaction domains 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) chr1.CM0195.330.nc
Sequence length 258
Comment + phase: 0
Sequence
MDEEKSVSNVETSKAERSVWLMKCPVVVAKSWQNHHPSPSQPLSKVVLSLDPLLPEDDPS
HLQFTMEMTGSEAVNMPKTYALNMFKDFVPMCVFSETSQGGKVAMEGKVEHKFDMKPHGE
NIEEYGKLCRERTNKSMIKNRQIQVIDNDRGVLMRPMPGMIGLVSSNSKDKKRTQPVKQS
DTKRTRRDRGELEDIMFKLFERQPNWALKQLVQETDQPAQFLKEILNELCVYNKRGANQG
TYELKPEYKKSVEDVKVE
Download sequence
Identical sequences I3T827
chr1.CM0195.330.nc

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]