SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383487788|ref|YP_005405467.1| from Rickettsia prowazekii str. Chernikova

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383487788|ref|YP_005405467.1|
Domain Number 1 Region: 196-356
Classification Level Classification E-value
Superfamily RalF, C-terminal domain 2.62e-73
Family RalF, C-terminal domain 0.0000256
Further Details:      
 
Domain Number 2 Region: 7-192
Classification Level Classification E-value
Superfamily Sec7 domain 3.53e-55
Family Sec7 domain 0.00000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383487788|ref|YP_005405467.1|
Sequence length 458
Comment protein transport protein SEC7 (sec7) [Rickettsia prowazekii str. Chernikova]
Sequence
MDSLLKNEVIKLFNDKPKSGIARIKKWCTDNNQDFIAETAKIFYEEKSNLNLEFVGDYLG
TDGVDNQKVLESFTKQFDFKEKDYLESLRRFLQSFKLPGEAQKIDRLVESFGTHYYEQNL
NIDINSKDAAYILAYQTIMLNTDLHNPSIAKSKKMTFEQLKNNLKGTNESKNFNDNFLKK
IYDEIEAKPFKLNFVDSSPGYQINNISSQNDKTFKQLNQFLEEKRNIQNIFPKLQNNNLT
IEFKNPKTFLSKFTGYKGSVIIKDEKSGAAEIQVYKPSIFSRWFLGEKSKIIIQPLREEG
RQPSEQSLKLAAQITASFETKVTSIKATYDYLKEDLKSQYDNIRNPKKELEKASAIAEGH
KNIKYITEIVHQINQPVKNAVAVFSSTISVEPQISKSDLPIKPPQLPVPKSIPNVVKKAA
KDISKQIPHERDKHKEELAKALEIQRRKIEKQNSGRVV
Download sequence
Identical sequences gi|478693609|ref|YP_007750516.1| gi|383499614|ref|YP_005412975.1| gi|478693131|ref|YP_007750039.1| gi|383487788|ref|YP_005405467.1| gi|383488635|ref|YP_005406313.1| gi|383489475|ref|YP_005407152.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]