SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|217076377|ref|YP_002334093.1| from Thermosipho africanus TCF52B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217076377|ref|YP_002334093.1|
Domain Number 1 Region: 264-526
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.58e-64
Family Tandem AAA-ATPase domain 0.0000000216
Further Details:      
 
Domain Number 2 Region: 91-261
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.06e-44
Family RecG "wedge" domain 0.0000172
Further Details:      
 
Domain Number 3 Region: 466-674
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.21e-44
Family Tandem AAA-ATPase domain 0.00000135
Further Details:      
 
Domain Number 4 Region: 1-86
Classification Level Classification E-value
Superfamily RecG, N-terminal domain 1.14e-26
Family RecG, N-terminal domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|217076377|ref|YP_002334093.1|
Sequence length 769
Comment ATP-dependent DNA helicase RecG [Thermosipho africanus TCF52B]
Sequence
MLIEDFLDEILNIKDHKALIEYVEDNFEKIDDPLKEDPEVFKRLQEFYTYIVEMKNLPER
RIQKRLSYIPGMVKRFKLMHLVYKVEKSSDLKPLDTPIKYVKGIGPKRAQKFLKLNVNNV
EQLLNFFPRDYEDRRRIIPIPLLREDDKVVTTGKLTGVEKVKKGNLTIVSAVLSDGMYQI
LLKWFNQDFMEGILKGLLRKKLYVFGTVKKGFYGSLEIHNPEIELFNENKREIFPIYPLT
EGLNQNTVRRIISENIYNIYNFKEHLPDDLISKRDLLDVYQAYTGMHFPRSNFHKKAARY
RLAYEEILYLQVAFLLSKKENEKIGGISKKFNGKYSTELINSLSFELTNAQKKAYEEIKN
DLKSDKPMNRLLQGDVGSGKTIVSELAMLDNYEAGFQSAVMVPTSILAIQNFKKIYDHFS
RFGIKVALLIGATSNSEKERIKQRLKDGDIDVVVGTHALIQEDVHFKNLGLVVIDEQHRF
GVEQRKELISKGKLVDTLVMTATPIPRTLSLSLYGDLDVSIIDEMPKGRKPIKTFVVHQS
KIEEVYKFVISEVENGGQAYIVYPLIDESEKLAVKSATSMYEVLTKEYFPDIPVGLIHGK
MSDSEKDDIMYKFASGEIKILVSTSVIEVGIDVPQATVIVIENAERFGLAQLHQLRGRVG
RGNKQSYCYLTVGNVSREAFERLNFFASTNDGFKISEFDLKLRGPGEFLGVRQHGLPEFK
VADIINDIDIIMVAREDAKYIIENEEKYRDLISYVKDLYKERLKLLDVG
Download sequence
Identical sequences B7IF88
484019.THA_250 gi|217076377|ref|YP_002334093.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]