SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|217077154|ref|YP_002334870.1| from Thermosipho africanus TCF52B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217077154|ref|YP_002334870.1|
Domain Number 1 Region: 1-217
Classification Level Classification E-value
Superfamily CbiG N-terminal domain-like 3.4e-63
Family CbiG N-terminal domain-like 0.0000981
Further Details:      
 
Domain Number 2 Region: 203-318
Classification Level Classification E-value
Superfamily CobE/GbiG C-terminal domain-like 2.88e-28
Family CobE/GbiG C-terminal domain-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|217077154|ref|YP_002334870.1|
Sequence length 330
Comment cobalamin biosynthesis protein CbiG [Thermosipho africanus TCF52B]
Sequence
MKIAILSITKNGAELSKRLFNSIKCDVYVKEDFKFNGAKVIDFLLKRFVKKIFKMYDALV
FIMATGIVVRVIADCLKDKFDDPAVVVIDEKGNFVISLLSGHVGGANELAKRLSKILDAV
PVITTASDVNGIESIDMIAKRYGFEIERREDLSKVSAAIVNKEHVDFILDSELDIDVESK
SYIDSTAQVYITNKVVFSKKPHVILRPKNLVVGIGCKKNIQIKKLLQFVESSLVFLNLSK
NSIRAIATIELKKKEDALLKLSKYLNVPLKIYSVEDIKKVESLFEGSEFVKKIIGVGSVA
RPVGYLESNMGKELFYSKKDGMVLSIYQDR
Download sequence
Identical sequences B7IHG5
gi|217077154|ref|YP_002334870.1| 484019.THA_1073 WP_012579979.1.97851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]