SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|389860347|ref|YP_006362586.1| from Thermogladius cellulolyticus 1633

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389860347|ref|YP_006362586.1|
Domain Number 1 Region: 96-273
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.01e-28
Family RIO1-like kinases 0.00041
Further Details:      
 
Domain Number 2 Region: 7-89
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000144
Family Rio2 serine protein kinase N-terminal domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|389860347|ref|YP_006362586.1|
Sequence length 292
Comment riO-like serine/threonine kinase [Thermogladius cellulolyticus 1633]
Sequence
MPNLGLIYRSLNEDDFKVLRAMERLSKRRDFIPLEDIVRETRIYEEKASLVLHKLHKLKL
VKSALTGPSRSFRLTYLALDMLALKSLVDQNIVSAIGDKVGVGKESDLYKAMSPSGEALI
IKFLRIGRSSFRRTRLLRSWAQSPTTTWFEQSKAAAEREYKALVDLYSNKANVPRPYGFN
RHATVMEFIDGVELYRRPTLRDPWKVLEQIFETLRIAYSKVGIVHGDLSEYNIIVSKNDE
RPYIIDWPQFVYKEEPNALPLLSRDVKYILRFFGKVYGVGGDPGEVVKYITS
Download sequence
Identical sequences I3TCG0
gi|389860347|ref|YP_006362586.1| WP_014736699.1.39459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]