SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|389860585|ref|YP_006362825.1| from Thermogladius cellulolyticus 1633

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389860585|ref|YP_006362825.1|
Domain Number 1 Region: 5-77,166-337
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 9.77e-73
Family Pyruvate kinase 0.0000255
Further Details:      
 
Domain Number 2 Region: 321-453
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 0.00000000000000421
Family Pyruvate kinase, C-terminal domain 0.0063
Further Details:      
 
Domain Number 3 Region: 72-161
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 0.0000000000000174
Family Pyruvate kinase beta-barrel domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|389860585|ref|YP_006362825.1|
Sequence length 473
Comment pyruvate kinase [Thermogladius cellulolyticus 1633]
Sequence
MAGLKTKIIVTLGPATKSYDIIKRLIKEGVSGFRINFSHGDTSEWDLFVKLVREAASELD
QPTSLIGDLRGPQIRIGVLDQGVLKVERDQVLRFVFGEKAGEKEIPVRSKSLFETVEVGD
TILVGDGECILRVVEVGDDYFQARALYDGVIGSGKKIVARGKEPNVPLLSSEDVSLVKYA
VDREFTFIGVSYVRSGHDINVVRNLIEGMKGSTGIIAKIETPTAYRNLAEIVSSSDMVLI
ARGDLGLHFDLEKLPTIQKEVIISSVSYGRPVIVATQILESMVEQPRPSRSEVVDVYSAV
QDMVDALMLTNETAVGKYPLETVRWLKKIIESAEANIKVEQAKSIRDSLAKRSLKDKYVH
GLLSLAESVEGKVLVFSKTGSVPPLIARMRPQVPVIVGTPDRRLAERLTLFYGLKVYDMS
KNVQGDVSYEEGIRLLESLARSRGELSIGDVVAESFARPGEDMHEILIKRILF
Download sequence
Identical sequences I3TD49
WP_014736937.1.39459 gi|389860585|ref|YP_006362825.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]