SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|389860661|ref|YP_006362901.1| from Thermogladius cellulolyticus 1633

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389860661|ref|YP_006362901.1|
Domain Number 1 Region: 50-114
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.0000000406
Family Ribosomal protein S4 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|389860661|ref|YP_006362901.1|
Sequence length 250
Comment 30S ribosomal protein S4e [Thermogladius cellulolyticus 1633]
Sequence
MTGSRHLKALAAPYYWPILRKEYKWTVRPSPGPHPTEYSLPLLIVVRNVLGYAETAREAR
RLISEGHFEIDGRVVRDYKFPVGFMDVLRIKPTDEYYRVVPVPTKVIGFVKIPKEEAAFK
LCRIQNKTTVKGGHIQLNLHDGRNVLIRVNDPRNPVEDVYETLGTVQLSLADNKIVDYVP
LAENNLVIISGGRNVGRVGLLKKVHRGMGVKRSVAVIEDKNGNLFQTSLSYVFVIGRDKP
LITLPEAVWK
Download sequence
Identical sequences I3TDC5
gi|389860661|ref|YP_006362901.1| WP_014737013.1.39459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]