SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|389860677|ref|YP_006362917.1| from Thermogladius cellulolyticus 1633

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389860677|ref|YP_006362917.1|
Domain Number 1 Region: 6-171
Classification Level Classification E-value
Superfamily Pseudouridine synthase 3.74e-46
Family Pseudouridine synthase II TruB 0.00000626
Further Details:      
 
Domain Number 2 Region: 172-254
Classification Level Classification E-value
Superfamily PUA domain-like 3.09e-19
Family PUA domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|389860677|ref|YP_006362917.1|
Sequence length 264
Comment pseudouridylate synthase TruB domain-containing protein [Thermogladius cellulolyticus 1633]
Sequence
MGRGYPKVTGVLPVGLENATKVIGNVIHTVKEYVMVIQLHDVVNEESLRRAVEYFKGEIY
QRPPLRSSVKRTLRKRNVYEIELLEYRDKFALVRVLSDPGTYMRKIAHDIGLILGVGAHM
RELRRTRTGPFKEDETLSTMQEVMEAVTLWREKGDERLLRRVVQPVEVSVVHLPKVMVLD
TAVDAIAHGANLAAPGVASVTSDVRRGFAVAVFTLKGELVSLGVSQHDAAEIKNMNKGIV
VKTKRVYMQPGIYPQAWKRQVSKS
Download sequence
Identical sequences I3TDE1
WP_014737029.1.39459 gi|389860677|ref|YP_006362917.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]