SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|389860735|ref|YP_006362975.1| from Thermogladius cellulolyticus 1633

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389860735|ref|YP_006362975.1|
Domain Number 1 Region: 9-178
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.72e-48
Family Ribonuclease PH domain 1-like 0.00000277
Further Details:      
 
Domain Number 2 Region: 152-237
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.23e-21
Family Ribonuclease PH domain 2-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|389860735|ref|YP_006362975.1|
Sequence length 242
Comment ribosomal RNA-processing protein RRP41/SKI6 [Thermogladius cellulolyticus 1633]
Sequence
MSESKPKLIREDGLRVDGRKPDELRPIRMEIGVLKNANGSALVEYGGTKVLAAVYGPREV
IPKAVQLPDRAVLRVRYHMAPFSTTEHKSPAPTRREIELSKVIREALESVVFADQFPRAS
IDVFIEVIQADGGTRTAGLTAASLALADAGIPMKDLVAGVAVGKVEGVLVLDINELEDEY
GEADLPVGYAVGIGEIVLLQLNGVLTVEEFKKAIELAKRGAEKVYALMKETLHKKYLSAL
ES
Download sequence
Identical sequences I3TDJ9
WP_014737087.1.39459 gi|389860735|ref|YP_006362975.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]