SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|389860742|ref|YP_006362982.1| from Thermogladius cellulolyticus 1633

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389860742|ref|YP_006362982.1|
Domain Number 1 Region: 8-263
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.31e-66
Family G proteins 0.00000563
Further Details:      
 
Domain Number 2 Region: 468-628
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.31e-52
Family Translational machinery components 0.0000246
Further Details:      
 
Domain Number 3 Region: 260-380
Classification Level Classification E-value
Superfamily Translation proteins 5.5e-30
Family Elongation factors 0.001
Further Details:      
 
Domain Number 4 Region: 629-724
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 2.01e-22
Family EF-G/eEF-2 domains III and V 0.0017
Further Details:      
 
Domain Number 5 Region: 393-468
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.51e-19
Family EF-G/eEF-2 domains III and V 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|389860742|ref|YP_006362982.1|
Sequence length 736
Comment elongation factor EF-2 [Thermogladius cellulolyticus 1633]
Sequence
MVKYKQTSEVLKIMKNLEQVRNIGITAHVDHGKTTLSDSLLAMAGLLSEKIAGQALALDY
LDIEQKRQMTVKAANVSLYHEYRGKPYVINLIDTPGHVDFQSKTIRALRVIDGAIVVVDA
VEGVMTQTEMYLRVALEEMVRPVLFINKIDRLIKELKLSPTEIQQRLVQIIKDINSLIAT
YADKEFRTAWQLDPAKGQVVFGSARDRWGFSVPMAQQKGIKFSDVVDVYQRGKDALPELQ
KVAPLHEAILDMVVKYVPNPREAQAYRIRKIWHGDLNSEVAKTMLEADPNGPLVMLVNDV
RVDPHAGLVATGRVYSGTVRAGEELWLVNARLKQRVLQVGLYMGPYRELADEISAGNIAA
VLGLDKARSGETVCSLAVRDSMTPFERLRMITESVVTVAIEPKDPSQLTKLIDAMHKLSI
EDPSLVVKINEETGEFLLSGVGTLHIEIALTLLKDFYGLEVVATPPVIVYRESVRAGSRV
FEGKSPNKHNKLYISVSPLDENTIRLIQDRIITEDMDPRDRAKILREQAGWDADEARRIW
AIDDNINVFVDMTTGVQYLRDVKDTIIQGFRLAMREGPLAMEPVRGVKVVLHDAVIHEDP
AHRGPAQLFPAVRNAIYAGMLTSRPTLLEPIMKLDIRTPMEFIGNISTIITKKRGKLIEV
QQQGNLSRVIAEIPVAESFTIAEELRSATAGKAIWGQEFSRWAPVPDSMLMDLVAKIRER
KGLKPEPPRPEDFLGP
Download sequence
Identical sequences I3TDK6
WP_014737094.1.39459 gi|389860742|ref|YP_006362982.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]