SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|389860813|ref|YP_006363053.1| from Thermogladius cellulolyticus 1633

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389860813|ref|YP_006363053.1|
Domain Number 1 Region: 317-429
Classification Level Classification E-value
Superfamily Pseudouridine synthase 0.000000000224
Family Pseudouridine synthase II TruB 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|389860813|ref|YP_006363053.1|
Sequence length 437
Comment pseudouridylate synthase [Thermogladius cellulolyticus 1633]
Sequence
MSVDDVIGRVEKALLKYPLCDHCLGRLFAKMGRELGNEERGRALKTLLSMVYDLKLRTAG
EGGVKEELYTLARHGGEPLTRLYKRVYGEDVAVDKCYVCGGLLSRTLFNELAEKVSAYLR
DLDASTFLVGVKLEQSVLEHELEVARVAGFDYSESIKNEVKREVGKRVAQITGLQPSFTN
PDVVAIIHIPSLHVELEVKPVYLRGYYVKTGRNISHTPWITSDGARKYPLSIQEFVDSRL
RDLFKADAVLIHAAGREDVDARMVGTGRPLVVEVVRPRRRKVGLSELNSLLEGGAVTVRL
EGYAQPRDKRVVKENLGKKAKVYKVLVLLGGEVNGDKLRQLEDSFQERVVTQRTPTRVLR
RKKDIARRRKVYSVKVASVMGRLVEVLIYCESGLYVKELVHCDNGRTDPCFAGVLGVQAL
PLELDVLGFAGRPGLDF
Download sequence
Identical sequences I3TDS7
gi|389860813|ref|YP_006363053.1| WP_014737165.1.39459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]