SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|389860856|ref|YP_006363096.1| from Thermogladius cellulolyticus 1633

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389860856|ref|YP_006363096.1|
Domain Number 1 Region: 11-140
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.9e-33
Family Translational machinery components 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|389860856|ref|YP_006363096.1|
Sequence length 140
Comment 30S ribosomal protein S9 [Thermogladius cellulolyticus 1633]
Sequence
MSSQEVSGHKIVVSSGKRKTSVAVATIKPGKGRVWVNNVPLEVIPIELAKNKILEPLLLI
GDLRNAIDVKVRVRGGGWMSQAEASRIAIARGIVEYFGLEEIKRVYKDYDRHMLSGDPRQ
TEPEKWGRISARRRWQKSYR
Download sequence
Identical sequences I3TDX0
WP_014737208.1.39459 gi|389860856|ref|YP_006363096.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]