SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|389861047|ref|YP_006363287.1| from Thermogladius cellulolyticus 1633

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|389861047|ref|YP_006363287.1|
Domain Number - Region: 11-106
Classification Level Classification E-value
Superfamily Prefoldin 0.0288
Family Prefoldin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|389861047|ref|YP_006363287.1|
Sequence length 136
Comment hypothetical protein TCELL_0725 [Thermogladius cellulolyticus 1633]
Sequence
MIVREFKSVGELIKFIDEQINSYRALLAEFLRRLEDVRVRSEQEKKLKDLLKNLGVAETK
KSTVIDLKDSKLIIDPSAEEESKVIEETVERLNKNIQVLQSIRKTLDPLANLDIEAKITV
VLRDGIPASVLIKLGS
Download sequence
Identical sequences I3TEG1
gi|389861047|ref|YP_006363287.1| WP_014737399.1.39459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]