SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|389861190|ref|YP_006363430.1| from Thermogladius cellulolyticus 1633

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389861190|ref|YP_006363430.1|
Domain Number 1 Region: 12-72
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000212
Family PH0730 N-terminal domain-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|389861190|ref|YP_006363430.1|
Sequence length 248
Comment hypothetical protein TCELL_0868 [Thermogladius cellulolyticus 1633]
Sequence
MHDLSKDETLTAKILRFVMENPGVSAKDVAEYLAISPNLARNVLQKLRDKGLVRKEGRGF
YITPRGEWLLSRAKTSRVEEAGKEQVVEPPAEARVSEPSAAEMPGEDRCRALEERIRNLE
ERLRRVEEIVAKFVKTGGQSGVPEPPRGDVERGKQLPRPPKPVMSVQEALAQYPGMLEQW
RIEGVVVQVGNLVVERRFLAEFAKKFPLPVDEVERLDPVERALFEELRREALVILHSGRE
YRLVKNLS
Download sequence
Identical sequences I3TEV4
gi|389861190|ref|YP_006363430.1| WP_014737542.1.39459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]