SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|389861211|ref|YP_006363451.1| from Thermogladius cellulolyticus 1633

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389861211|ref|YP_006363451.1|
Domain Number 1 Region: 2-161,290-373
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.86e-54
Family Bacterial dinuclear zinc exopeptidases 0.00081
Further Details:      
 
Domain Number 2 Region: 161-285
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.00000000000000126
Family Bacterial exopeptidase dimerisation domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|389861211|ref|YP_006363451.1|
Sequence length 378
Comment succinyl-diaminopimelate desuccinylase [Thermogladius cellulolyticus 1633]
Sequence
MVDYYREVLSSHGVHVTVHRVDDDYVRKHLPREYNPDKPRYILLARVGSGERVLQFNGHY
DVVAAGEGWETPPFQPVVKDGLVYGRGATDMKGGIASVVGALAYVASGKEPEIVVEAALV
PDEEIGGLTGTGYLVNVLGSRPDWVVIAEPSGIDNIYIGHRGGVWAMVKVYGVQAHGSTP
WLGDNAFEKMVYLAKLFIEEYKPSLAQRRSRFEYEMPEASNPTLTLGGKLVAPGSINIVP
GIVGFSVDRRLIVEERADEVVEELRRFLENASARLGVRAELEVMEKSDPALTDPGSHLVR
VLEDSITGTLNLKPRKTICVGGLDLRYYAAKNIQAVAYGPGEVGMAHKVNEYVKLADIVK
VAETYVDLVYRLSPGTSR
Download sequence
Identical sequences I3TEX5
gi|389861211|ref|YP_006363451.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]