SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|389861372|ref|YP_006363612.1| from Thermogladius cellulolyticus 1633

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389861372|ref|YP_006363612.1|
Domain Number 1 Region: 96-266
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 5.89e-32
Family Dihydroorotate dehydrogenase B, PyrK subunit 0.085
Further Details:      
 
Domain Number 2 Region: 11-101
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 0.00000000000181
Family Ferredoxin reductase FAD-binding domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|389861372|ref|YP_006363612.1|
Sequence length 275
Comment [NiFe] hydrogenase, gamma subunit [Thermogladius cellulolyticus 1633]
Sequence
MRSPFAELRKGLVIGEVYEAPGVKTLAVRLVDEVPPPRPGQFNMVYVHGLGEVPLSVSGI
REGGRVVEHTVRAAGAVTRALVYREWRGCLVGLRGPYGRGWPLEEAEGHDLLVVAGGMGF
APLRPVLKWVAERRERYGRVNVLVGARTPRDLLFKYELESYRGLPGTRLLLSVDRPEGAW
EGHVGLVTDLIRLADVDPGGSYAFVCGPEPMMVNTVKALKERGFREDRVFLSLERRMRCG
TGFCGTCQLGHYFTCRDGPVFRLTEVSDYLAVEGV
Download sequence
Identical sequences I3TFD6
WP_014737724.1.39459 gi|389861372|ref|YP_006363612.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]