SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|389861421|ref|YP_006363661.1| from Thermogladius cellulolyticus 1633

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389861421|ref|YP_006363661.1|
Domain Number 1 Region: 13-76
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000107
Family Transcriptional regulator IclR, N-terminal domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|389861421|ref|YP_006363661.1|
Sequence length 171
Comment regulatory protein MarR [Thermogladius cellulolyticus 1633]
Sequence
MRDRLLKQSHLKILLLSDENGYLDLGSVQQKLNLTMSSLRKYVRQLEKDGLVARSEKGLV
LTEKGLKLKKTILNLKTKRDVPAYLITDPSTGQPVPVSFKSYAQLYALLAYDLVDKTLVD
KHIAQGYLANWARDAVGDEYLASLIQSGGVKNSNDLLSYLKMILQLVAVEK
Download sequence
Identical sequences I3TFI5
gi|389861421|ref|YP_006363661.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]