SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|389861423|ref|YP_006363663.1| from Thermogladius cellulolyticus 1633

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389861423|ref|YP_006363663.1|
Domain Number 1 Region: 4-225
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.87e-57
Family ABC transporter ATPase domain-like 0.00000276
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|389861423|ref|YP_006363663.1|
Sequence length 239
Comment ABC transporter [Thermogladius cellulolyticus 1633]
Sequence
MAVAVRVEHLRKAFGRVVAVEDVTLEVYEGEIFGLIGPNGAGKTTTLRMIAGLVKPDSGM
VSIMGLDPFKESGEAKRVLGYLPEEADVYTRLTGLEHLKFYASIYGGDVDETVRYGATVS
GLGGDLYKKAGEYSKGMKRRLLLSLVLMRKPKVALLDEPTSGLDVYSSIKVRDLIKGFAR
ENKSTIILSSHNMLEVEYVCDRVAFINKGRVVEVGSPSDLKRKYGASNLEEVFVRATGG
Download sequence
Identical sequences I3TFI7
WP_014737775.1.39459 gi|389861423|ref|YP_006363663.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]