SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|389861440|ref|YP_006363680.1| from Thermogladius cellulolyticus 1633

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389861440|ref|YP_006363680.1|
Domain Number 1 Region: 3-85
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 0.00000000000811
Family Ferredoxin reductase FAD-binding domain-like 0.015
Further Details:      
 
Domain Number 2 Region: 104-243
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 0.0000000000547
Family Dihydroorotate dehydrogenase B, PyrK subunit 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|389861440|ref|YP_006363680.1|
Sequence length 269
Comment ferredoxin:NADP oxidoreductase, small subunit [Thermogladius cellulolyticus 1633]
Sequence
MKEDLNDQDYYLEVEAPHVTKHWKPGQFVIIMTHEKGERVPLSVATINGGRVGMFIKKLG
KTSVELYREFRVGSSLYAVSGPLGKPLKLEDYGTVVLASDAVCGHAEQLGLAQELAKLGN
KVISIQTFKTEKEVYPEKYLTTKYADEHYITTLDGTAGYKGHYIDLLRELVARREVKAVF
AGGALASLKKLAEATAGLDAKVYALVRTIMVDGTGMCGSCRVRYNGVIAYACRDGPWFDA
RLVDWDDVLRRDARFKKIEKIALEKYLAR
Download sequence
Identical sequences I3TFK4
WP_014737792.1.39459 gi|389861440|ref|YP_006363680.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]