SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|389861465|ref|YP_006363705.1| from Thermogladius cellulolyticus 1633

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389861465|ref|YP_006363705.1|
Domain Number 1 Region: 157-440
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.62e-73
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000538
Further Details:      
 
Domain Number 2 Region: 6-113
Classification Level Classification E-value
Superfamily tRNA-binding arm 4.81e-23
Family Seryl-tRNA synthetase (SerRS) 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|389861465|ref|YP_006363705.1|
Sequence length 460
Comment seryl-tRNA synthetase [Thermogladius cellulolyticus 1633]
Sequence
MSWSILKLLRENPEELKNHVKKRFMDVSIVDEALKADLEWRRILAEIQELRHKHNVISRE
VSRLQGPEREEKIKEAKELLSLIEVYEKKLSEVEAKREEILLKLPNIVHESVPIGPDDSY
NVPIRFYGRPRVWKGYLEQFKQQTEKYGFKVDYELIDWKPVGHADMLENVLGLGNTVKAG
EVAGSRFYYLFDDIVFLDMALLAYAIDYLTSRGYTLVLPPYMLRFKYIQGVLDYATFKDA
IYKVEGEDLYLIATAEHSLAALHADEDIPEEALPLKYVGVSPCFRKEAGAGSRDLKGIFR
VHQFHKVEQFVYAKPEESWDVMEELINNAEELFKGLELPYRVVNIASGDLGAPAAKKYDL
ETWMPAQGLYREMVSCSNVTDWQAYRLKIRLVRRKGMVKEYVHTLNSTAIASTRTITSIL
ENYQEPDGVVVVPRALRKYLEPFSKAPKDAIHPVKREKAV
Download sequence
Identical sequences I3TFM9
WP_014737817.1.39459 gi|389861465|ref|YP_006363705.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]