SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|389861584|ref|YP_006363824.1| from Thermogladius cellulolyticus 1633

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389861584|ref|YP_006363824.1|
Domain Number 1 Region: 7-148
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.000000013
Family GHMP Kinase, N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|389861584|ref|YP_006363824.1|
Sequence length 311
Comment GHMP kinase [Thermogladius cellulolyticus 1633]
Sequence
MSRGVEVSAPSRLHFGLVNPHGVAPYRLYGSAGVAVKSPRVVVEVYPSDRFELPPVLEEG
EKATLASVLRGRGVRGVRAVVREVPPRHAGFGTTTQLLLSIAVGALRLHGIEYSPLDLAW
ELGRGRVSSIGVYSFMRGGFIVDAGRGRSTRIAPLAVRLDFPEEWRFVLILPRGTGLSGE
EEERAMRRPKFYEVARVHEAAWLLHYGLVPAVIERDPSTFAEALGRLQELVGGFFQEEQG
GLFNPASAKVVEHLEKLGVRGYGQSSWGPLIYVFAESEGRAREVADSVSRLGEYRVCVTG
ADNRGAVIREV
Download sequence
Identical sequences I3TFZ8
WP_014737936.1.39459 gi|389861584|ref|YP_006363824.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]