SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|389860617|ref|YP_006362857.1| from Thermogladius cellulolyticus 1633

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389860617|ref|YP_006362857.1|
Domain Number 1 Region: 309-471
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.39e-53
Family DNA gyrase/MutL, second domain 0.00000278
Further Details:      
 
Domain Number 2 Region: 19-229
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.75e-37
Family DNA gyrase/MutL, N-terminal domain 0.000000429
Further Details:      
 
Domain Number 3 Region: 232-304
Classification Level Classification E-value
Superfamily S13-like H2TH domain 0.00000000104
Family Topoisomerase VI-B subunit middle domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|389860617|ref|YP_006362857.1|
Sequence length 529
Comment DNA topoisomerase VI subunit B [Thermogladius cellulolyticus 1633]
Sequence
MSGETVEKYKAISPAEFFYKYKEIAGFANPARALYQTVRELVENALDATDSHGILPDIKV
VIQRADPVQEFYRVTVEDNGIGIPPDIVPNAFGRVLFSSKYVLRQTRGMYGLGVKMAVLY
GQMTTGRPIEVITSKREYRRIYFFKIRIDINKNEPVVLERGSWRKQRDWHGTIVSLTIEG
DWGKAKARIKEYINRTATVTPYANIVMYTPDNEVTLYKRVIETMPRPPKEVKPHPYGVDL
EMLKMIIESGKEPTILEVLVENFQSVGEVTAKDLLSKAGIDPSSNPRNLKEDDLLRLINT
MKSYNQFKPPSSSAISPLGVEVIKAGLTRMFEPEFVDAVTRKPSTYEGHPFIVEAGIAYG
GKVPLSEADKPILLRYANKIPLLYDEGSDVITSVVKEDIAWDNYMVAFPAQLVLLVHVCS
TKVPFKGVGKESIADVPEVRREIKLAISEVARRLRGYLTAKQKELETQRKVVHLAKYIPE
IARSLEVIFSGDGFDKGTLVKKLVGIISAKTGIPENKINEVIRGVEIGA
Download sequence
Identical sequences I3TD81
WP_014736969.1.39459 gi|389860617|ref|YP_006362857.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]