SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|197117547|ref|YP_002137974.1| from Geobacter bemidjiensis Bem

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197117547|ref|YP_002137974.1|
Domain Number 1 Region: 345-371
Classification Level Classification E-value
Superfamily Fibritin 0.00000314
Family Fibritin 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|197117547|ref|YP_002137974.1|
Sequence length 385
Comment hypothetical protein Gbem_1159 [Geobacter bemidjiensis Bem]
Sequence
MRRLLFALNLSALLLALLVAPALAAPADQAERKLQGAPVSLKHAELMALRNQGGFVPGQW
YRIADFRTRWRSYITGIVHEAPVEPLLVQAITSNRLAILAYSERYPNDEIDYLIYDGSLH
GEIVNGVEIPSNDRGGIVRRKDINRGIECWFDFRAYTVRLFETAPGSGVYRDYGKGPAYV
DRPLLQVDNSSQVVIKKAGIPWRGEDGAVADNMGYGNPEHYLEAANKVQIGMNSFNIKIY
GNEVTSALFGECTDDIVCEGSWRNSQMVGFNNTVNFGGTVETSFFMGGTEVAKVSGDVTR
SVFLPGVVHATFNGRLTECMVFSGVDSKSYDGDRRGEFIGQSAEAIGAVGDAPKDGKLYV
RQNGRWVELVTAAPALRQQNAKGRQ
Download sequence
Identical sequences B5EHG8
gi|197117547|ref|YP_002137974.1| WP_012529591.1.31571 404380.Gbem_1159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]