SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|197117715|ref|YP_002138142.1| from Geobacter bemidjiensis Bem

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197117715|ref|YP_002138142.1|
Domain Number 1 Region: 97-234
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.64e-25
Family DsbC/DsbG C-terminal domain-like 0.014
Further Details:      
 
Domain Number 2 Region: 39-81
Classification Level Classification E-value
Superfamily DsbC/DsbG N-terminal domain-like 0.0000194
Family DsbC/DsbG N-terminal domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|197117715|ref|YP_002138142.1|
Sequence length 242
Comment protein disulfide bond isomerase [Geobacter bemidjiensis Bem]
Sequence
MWFTRRILAACLSAAVLLLLAGVSFAAPISPENAFRSAFPQVPFDSMTPTEIKGVYEVVS
GPNIFYYYPEKDLILTGEIVGKDLKSRTAERKQALSSQVAAKAMEAVKELPLDKAVKVGD
GKKTVIEFTDPDCPYCRKASEYFTKRSDVTRYVFFAPLAHPAAIKKIEYILSAENKAEAY
DAMMLGEEIPASAKPASAEVKKLAQEHLALARKVGIQGTPTFFVKGEQVIGADTKKLDEL
LK
Download sequence
Identical sequences B5EI82
WP_012529757.1.31571 gi|197117715|ref|YP_002138142.1| 404380.Gbem_1327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]