SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|209809713|ref|YP_002265252.1| from Aliivibrio salmonicida LFI1238

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|209809713|ref|YP_002265252.1|
Domain Number 1 Region: 3-292
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.64e-27
Family Thioesterases 0.00000000373
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|209809713|ref|YP_002265252.1|
Sequence length 295
Comment acyl transferase [Aliivibrio salmonicida LFI1238]
Sequence
MISLENGKTLRVWETLPKENTLKKNNTILIASGFARRMDHFAGLAEYLSSNGFHVIRYDS
LHHVGLSSGDINEFSMSIGKDSLLTVIDWLKGRNIEKLGLIAASLSARIAYEIANEIDLS
FLVTAVGVVNLRDTLERALKYDYLQLPIEKLPEDLDFEGHNLGSEVFVTDCFKHKWDTLD
STINKMKNLDVPFIAFTANDDNWVKQSEVLDLLISLNSEKCKLYSLIGSSHDLGENLVVL
RNFYQSVTKAAIALDNDSLDLDVNMTEPRFEDITSVTVKERRLKNQIENESLELV
Download sequence
Identical sequences B6ESM6
316275.VSAL_II0963 gi|209809713|ref|YP_002265252.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]